System Facility ParametersThis chapter describes most of the parameters default values for various
system facilities.autofscrondevfsadmdhcpagentfsftpinetinitinitkeyservkbdloginmpathdnfsnfslogdnsspasswdpowerrpc.nisdsusyslogsys-suspendtarutmpdyppasswddSystem Default ParametersThe functioning of various system facilities is governed by a set of
values that are read by each facility on startup. The values stored in a file
for each facility are located in the /etc/default directory.
Not every system facility has a file located in this directory.<filename>autofs</filename>This
facility enables you to configure autofs parameters such
as automatic timeout, displaying or logging status messages, browsing autofs
mount points, and tracing. For details, see autofs4.<filename>cron</filename>This
facility enables you to disable or enable cron logging.<filename>devfsadm</filename>This file is not currently used.<filename>dhcpagent</filename>Client
usage of DHCP is provided by the dhcpagent daemon. When ifconfig identifies an interface that has been configured to receive
its network configuration from DHCP, it starts the client daemon to manage
that interface.For more information, see the /etc/default/dhcpagent information
in the FILES section of dhcpagent1M.<filename>fs</filename>File
system administrative commands have a generic and file system-specific portion.
If the file system type is not explicitly specified with the option,
a default is applied. The value is specified in this file. For more information,
see the Description section of default_fs4.<filename>ftp</filename>This facility enables you to set the ls command behavior
to the RFC 959 NLST command. The default ls behavior
is the same as in the previous Solaris release.For
details, see ftp4.<filename>inetinit</filename>This
facility enables you to configure TCP sequence numbers and to enable or disable
support for 6to4 relay routers.<filename>init</filename>For
details, see the /etc/default/init information in the
FILES section of init1M.All values in the file are placed in the environment of the shell that init invokes in response to a single user boot request. The init process also passes these values to any commands that it starts
or restarts from the /etc/inittab file.<filename>keyserv</filename>For
details, see the /etc/default/keyserv information in
the FILES section of keyserv1M. <filename>kbd</filename>For
details, see the Extended Description section of kbd1.<filename>login</filename>For
details, see the /etc/default/login information in the
FILES section of login1.<filename>mpathd</filename>This facility enables you to set in.mpathd configuration
parameters.For
details, see in.mpathd1M.<literal>nfs</literal>This facility enables you to set NFS daemon configuration
parameters.For details, see nfs4.<filename>nfslogd</filename>For
details, see the Description section of nfslogd1M. <literal>nss</literal>This facility enables you to configure initgroups(3C) lookup
parameters.For
details, see nss4.<filename>passwd</filename>For
details, see the /etc/default/passwd information in the
FILES section of passwd1.<filename>power</filename>For details, see the /etc/default/power information
in the FILES section of pmconfig1M.<filename>rpc.nisd</filename>For details, see the /etc/default/rpc.nisd information
in the FILES section of rpc.nisd1M.<filename>su</filename>For details, see the /etc/default/su information
in the FILES section of su1M.<filename>syslog</filename>For details, see the /etc/default/syslogd information
in the FILES section of syslogd1M.<filename>sys-suspend</filename>For
details, see the /etc/default/sys-suspend information
in the FILES section of sys-suspend(1M).<filename>tar</filename>For
a description of the function modifier, see tar1.If the TAPE environment variable is not present and
the value of one of the arguments is a number and is not
specified, the number matching the archiveN string
is looked up in the /etc/default/tar file. The value
of the archiveN string is used as the output device
with the blocking and size specifications from the file.For example: % tar -c 2 /tmp/*This command writes the output to the device specified as archive2 in the /etc/default/tar file.<filename>utmpd</filename>The utmpd daemon monitors /var/adm/utmpx (and /var/adm/utmp in earlier Solaris versions) to ensure that utmp entries inserted by non-root processes by pututxline(3C) are
cleaned up on process termination. Two entries in /etc/default/utmpd are supported: SCAN_PERIOD – The number of seconds
that utmpd sleeps between checks of /proc to see if monitored processes are still
alive. The default is 300. MAX_FDS – The maximum number of processes
that utmpd attempts to monitor. The default value is 4096
and should never need to be changed.<literal>yppasswdd</literal>This facility enables you to configure whether a user can successfully
set a login shell to a restricted shell when using the passwdnis command.For
details, see rpc.yppasswdd1M.